RALB Peptide - middle region
RALB Peptide - middle region
Product Specifications
UniProt
P36860
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RALB Rabbit Polyclonal Antibody (orb330853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002872
Preservative
Lyophilized powder
AA Sequence
FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15383149 1 Vial
Lentiviral human OTUD7A sgRNA gene knockout kit - Lentiviral human OTUD7A sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
MBS6163039-01 0.1 mL
WDR20 (WD Repeat Domain 20, DMR, FLJ33659, MGC33177, MGC33183) (AP)
Sign In for Pricing
View Details MBS6163039-02 5x 0.1 mL
WDR20 (WD Repeat Domain 20, DMR, FLJ33659, MGC33177, MGC33183) (AP)
Sign In for Pricing
View Details