Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALB Peptide - middle region

RALB Peptide - middle region

Product Specifications

UniProt

P36860

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RALB Rabbit Polyclonal Antibody (orb330853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002872

Preservative

Lyophilized powder

AA Sequence

FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose M9Y
0119 500 mL

Glucose M9Y

Sign In for Pricing
View Details
Recombinant Mouse AGER/RAGE Protein (His Tag)
PKSM040654 100 µg

Recombinant Mouse AGER/RAGE Protein (His Tag)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF640R conjugate, 0.1mg/mL
BNC402306-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), 0.2mg/mL
BNUB2181-500 1x 500 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), 0.2mg/mL

Sign In for Pricing
View Details
TentaGel® R HMPA
R28015.5G 5 g

TentaGel® R HMPA

Sign In for Pricing
View Details
EnzyChrom™ ADP Assay Kit
E2ADP-100 100 Tests

EnzyChrom™ ADP Assay Kit

Sign In for Pricing
View Details