Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP5 Peptide - N-terminal region

RANBP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686O1576, FLJ43041, IMB3, KPNB3, MGC2068, RANBP5, imp5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RANBP5 Rabbit Polyclonal Antibody (orb325876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002262

Preservative

Lyophilized powder

AA Sequence

GNNQWPEGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEGF11 Double Nickase Plasmid (m2)
sc-431909-NIC-2 20 µg

MEGF11 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
1,2,4,6-Tetra-O-acetyl-3-O-allyl-β-D-glucopyranose
GC0188-2g 2 g

1,2,4,6-Tetra-O-acetyl-3-O-allyl-β-D-glucopyranose

Sign In for Pricing
View Details
Recombinant Human MIP-3 (CCL23)
HECCP-2301 5 µg

Recombinant Human MIP-3 (CCL23)

Sign In for Pricing
View Details
RIP2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62783R-BF488 100 µL

RIP2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Tcp11 3'UTR Luciferase Stable Cell Line
TU120307 1.0 mL

Tcp11 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Csnk1g1 ORF Vector (Mouse) (pORF)
16945014 1.0 µg DNA

Csnk1g1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details