Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANBP5 Peptide - N-terminal region

RANBP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686O1576, FLJ43041, IMB3, KPNB3, MGC2068, RANBP5, imp5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RANBP5 Rabbit Polyclonal Antibody (orb325876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002262

Preservative

Lyophilized powder

AA Sequence

GNNQWPEGLKFLFDSVSSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[Ethyl (methyl) sulfamoyl]benzoic acid
UTB77757-01 50 mg

2-[Ethyl (methyl) sulfamoyl]benzoic acid

Sign In for Pricing
View Details
2-[Ethyl (methyl) sulfamoyl]benzoic acid
UTB77757-02 0.5 g

2-[Ethyl (methyl) sulfamoyl]benzoic acid

Sign In for Pricing
View Details
RCOR3 CRISPR/Cas9 KO Plasmid (h)
sc-412594 20 µg

RCOR3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Thermoplasma acidophilum Phosphoglycolate phosphatase (Ta0175)
MBS1293570-01 0.02 mg (E-Coli)

Recombinant Thermoplasma acidophilum Phosphoglycolate phosphatase (Ta0175)

Sign In for Pricing
View Details
Recombinant Thermoplasma acidophilum Phosphoglycolate phosphatase (Ta0175)
MBS1293570-02 0.1 mg (E-Coli)

Recombinant Thermoplasma acidophilum Phosphoglycolate phosphatase (Ta0175)

Sign In for Pricing
View Details
Recombinant Thermoplasma acidophilum Phosphoglycolate phosphatase (Ta0175)
MBS1293570-03 0.02 mg (Yeast)

Recombinant Thermoplasma acidophilum Phosphoglycolate phosphatase (Ta0175)

Sign In for Pricing
View Details