RAPGEF3 Peptide - N-terminal region
RAPGEF3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CAMP-GEFI, EPAC, EPAC1, MGC21410, bcm910, HSU79275
UniProt
A8K2G5
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAPGEF3 Rabbit Polyclonal Antibody (orb581587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006096
Preservative
Lyophilized powder
AA Sequence
RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741796-500 1x 500 µL
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
MC08F-PAG 10x 96 Well Plates
Protein A/G Coated - 96 well Solid plates - Clear PS
Sign In for Pricing
View Details 
BNC401516-100 1x 100 µL
FOXA1 / HNF3A (FOXA1/1516), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details