Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEF3 Peptide - N-terminal region

RAPGEF3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAMP-GEFI, EPAC, EPAC1, MGC21410, bcm910, HSU79275

UniProt

A8K2G5

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEF3 Rabbit Polyclonal Antibody (orb581587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006096

Preservative

Lyophilized powder

AA Sequence

RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP25 (NM_001168682) Human Over-expression Lysate
LY432676 100 µg

SAP25 (NM_001168682) Human Over-expression Lysate

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D6]
TA803220AM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D6]

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF647 conjugate, 0.1mg/mL
BNC471660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF647 conjugate, 0.1mg/mL
BNC471227-100 1x 100 µL

Thyroglobulin (TGB04 + TGB05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perforin (PRF1) Mouse Monoclonal Antibody [Clone ID: dG9]
AM00176RP-N 100 Tests

Perforin (PRF1) Mouse Monoclonal Antibody [Clone ID: dG9]

Sign In for Pricing
View Details
KTI3 Rabbit Polyclonal Antibody
TA397058S 25 µL

KTI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details