Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEF3 Peptide - middle region

RAPGEF3 Peptide - middle region

Product Specifications

Product Name Alternative

CAMP-GEFI, EPAC, EPAC1, MGC21410, bcm910, HSU79275

UniProt

O95398

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEF3 Rabbit Polyclonal Antibody (orb581588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092001

Preservative

Lyophilized powder

AA Sequence

HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS

More Discoveries

Explore Other Products

Browse additional items from our catalog

15-Dicaffeoylquinic acid
M20177-01 1 g

15-Dicaffeoylquinic acid

Sign In for Pricing
View Details
15-Dicaffeoylquinic acid
M20177-02 100 mg

15-Dicaffeoylquinic acid

Sign In for Pricing
View Details
15-Dicaffeoylquinic acid
M20177-03 200 mg

15-Dicaffeoylquinic acid

Sign In for Pricing
View Details
15-Dicaffeoylquinic acid
M20177-04 500 mg

15-Dicaffeoylquinic acid

Sign In for Pricing
View Details
15-Dicaffeoylquinic acid
M20177-05 2 mg

15-Dicaffeoylquinic acid

Sign In for Pricing
View Details
15-Dicaffeoylquinic acid
M20177-06 5 mg

15-Dicaffeoylquinic acid

Sign In for Pricing
View Details