RAPGEF3 Peptide - middle region
RAPGEF3 Peptide - middle region
Product Specifications
Product Name Alternative
CAMP-GEFI, EPAC, EPAC1, MGC21410, bcm910, HSU79275
UniProt
O95398
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAPGEF3 Rabbit Polyclonal Antibody (orb581588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001092001
Preservative
Lyophilized powder
AA Sequence
HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2084463-01 0.1 mL
HRP-Linked Polyclonal Antibody to Fc Fragment Of IgG Binding Protein (FcgBP)
Sign In for Pricing
View Details 
MBS2084463-02 0.2 mL
HRP-Linked Polyclonal Antibody to Fc Fragment Of IgG Binding Protein (FcgBP)
Sign In for Pricing
View Details MBS2084463-03 0.5 mL
HRP-Linked Polyclonal Antibody to Fc Fragment Of IgG Binding Protein (FcgBP)
Sign In for Pricing
View Details