Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARG Peptide - N-terminal region

RARG Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1B3, RARC

UniProt

P13631

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RARG Rabbit Polyclonal Antibody (orb575049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000957

Preservative

Lyophilized powder

AA Sequence

YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sciellin (SCEL)
MBS2034260-01 0.01 mg

Recombinant Sciellin (SCEL)

Sign In for Pricing
View Details
Recombinant Sciellin (SCEL)
MBS2034260-02 0.05 mg

Recombinant Sciellin (SCEL)

Sign In for Pricing
View Details
Recombinant Sciellin (SCEL)
MBS2034260-03 0.1 mg

Recombinant Sciellin (SCEL)

Sign In for Pricing
View Details
Recombinant Sciellin (SCEL)
MBS2034260-04 0.2 mg

Recombinant Sciellin (SCEL)

Sign In for Pricing
View Details
Recombinant Sciellin (SCEL)
MBS2034260-05 0.5 mg

Recombinant Sciellin (SCEL)

Sign In for Pricing
View Details
Recombinant Sciellin (SCEL)
MBS2034260-06 1 mg

Recombinant Sciellin (SCEL)

Sign In for Pricing
View Details