Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARG Peptide - N-terminal region

RARG Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1B3, RARC

UniProt

P13631

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RARG Rabbit Polyclonal Antibody (orb575049) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000957

Preservative

Lyophilized powder

AA Sequence

YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omeprazole Impurity 84
RM-O132384-01 10 mg

Omeprazole Impurity 84

Sign In for Pricing
View Details
Omeprazole Impurity 84
RM-O132384-02 25 mg

Omeprazole Impurity 84

Sign In for Pricing
View Details
Omeprazole Impurity 84
RM-O132384-03 50 mg

Omeprazole Impurity 84

Sign In for Pricing
View Details
Omeprazole Impurity 84
RM-O132384-04 100 mg

Omeprazole Impurity 84

Sign In for Pricing
View Details
Rabbit anti GluR1 Polyclonal Antibody
MBS460162-01 0.1 mg

Rabbit anti GluR1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti GluR1 Polyclonal Antibody
MBS460162-02 5x 0.1 mg

Rabbit anti GluR1 Polyclonal Antibody

Sign In for Pricing
View Details