Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rasa1 Peptide - C-terminal region

Rasa1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gap, MGC7759, RasGAP, Rasa

UniProt

Q91YX7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rasa1 Rabbit Polyclonal Antibody (orb578327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663427

Preservative

Lyophilized powder

AA Sequence

SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: left
CS711149 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Collagen VI (COL6A1) (NM_001848) Human Over-expression Lysate
LY419706 100 µg

Collagen VI (COL6A1) (NM_001848) Human Over-expression Lysate

Sign In for Pricing
View Details
MYBPC2 Human Gene Knockout Kit (CRISPR)
KN420058 1 Kit

MYBPC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (N/A), 0.2mg/mL
BNUB1816-100 1x 100 µL

Histone H1 (Pan Nuclear Marker) (N/A), 0.2mg/mL

Sign In for Pricing
View Details
N2-t-Boc-N6-(biotinamido-6-N-caproylamido)lysine
TRC-B642500-50MG 50 mg

N2-t-Boc-N6-(biotinamido-6-N-caproylamido)lysine

Sign In for Pricing
View Details
L-Serine
TRC-S270995-25G 25 g

L-Serine

Sign In for Pricing
View Details