Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASAL1 Peptide - C-terminal region

RASAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RASAL

UniProt

O95294

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASAL1 Rabbit Polyclonal Antibody (orb331178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004649

Preservative

Lyophilized powder

AA Sequence

DTTLEADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQERGKAALG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lactate Dehydrogenase Isoenzyme V Monoclonal Antibody
AN301095L-01 50 µL

Recombinant Lactate Dehydrogenase Isoenzyme V Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Lactate Dehydrogenase Isoenzyme V Monoclonal Antibody
AN301095L-02 100 µL

Recombinant Lactate Dehydrogenase Isoenzyme V Monoclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), 1mg/mL
BNUM0597-50 1x 50 µL

Alkaline Phosphatase (ALPL/597), 1mg/mL

Sign In for Pricing
View Details
Ezrin / p81 (CPTC-Ezrin-1), CF640R conjugate, 0.1mg/mL
BNC402238-100 1x 100 µL

Ezrin / p81 (CPTC-Ezrin-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GC1q R Recombinant Mouse monoclonal Antibody
HA610076 100 µg

GC1q R Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
1,2:4,6-Di-O-isopropylidene-L-sorbofuranose
TRC-D459275-500MG 500 mg

1,2:4,6-Di-O-isopropylidene-L-sorbofuranose

Sign In for Pricing
View Details