Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASAL1 Peptide - C-terminal region

RASAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RASAL

UniProt

O95294

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASAL1 Rabbit Polyclonal Antibody (orb331178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004649

Preservative

Lyophilized powder

AA Sequence

DTTLEADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQERGKAALG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]
TA800911BM 100 µL

CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]

Sign In for Pricing
View Details
GAD65 (GAD2) Human Gene Knockout Kit (CRISPR)
KN423464 1 Kit

GAD65 (GAD2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dopamine Transporter Recombinant Chimeric Antibody Antibody
HA610310 100 µg

Dopamine Transporter Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
E-AB-67463-01 60 µL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
E-AB-67463-02 120 µL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos Polyclonal Antibody
E-AB-67463-03 200 µL

c-Fos Polyclonal Antibody

Sign In for Pricing
View Details