Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Peptide - middle region

RASGRF1 Peptide - middle region

Product Specifications

Product Name Alternative

CDC25, CDC25L, GNRP, GRF1, GRF55, H-GRF55, PP13187, ras-GRF1

UniProt

Q13972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRF1 Rabbit Polyclonal Antibody (orb583195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002882

Preservative

Lyophilized powder

AA Sequence

PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protease Activated Receptor 1 ELISA Kit
MBS746647-01 48 Well

Rat Protease Activated Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Rat Protease Activated Receptor 1 ELISA Kit
MBS746647-02 96 Well

Rat Protease Activated Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Rat Protease Activated Receptor 1 ELISA Kit
MBS746647-03 5x 96 Well

Rat Protease Activated Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Rat Protease Activated Receptor 1 ELISA Kit
MBS746647-04 10x 96 Well

Rat Protease Activated Receptor 1 ELISA Kit

Sign In for Pricing
View Details
NUP155 (Nucleoporin 155kDa) Chicken ELISA Kit
F5098 96 Tests

NUP155 (Nucleoporin 155kDa) Chicken ELISA Kit

Sign In for Pricing
View Details
Arrdc1 discontinued
386146 200 µL

Arrdc1 discontinued

Sign In for Pricing
View Details