Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP4 Peptide - N-terminal region

RASGRP4 Peptide - N-terminal region

Product Specifications

UniProt

C0LTP7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRP4 Rabbit Polyclonal Antibody (orb585229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139679

Preservative

Lyophilized powder

AA Sequence

FWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Freezer Storage Box 100 Place for Microcentrifuge tubes; Blue, 5 each Pk
BB-3100-05-BL 5/PK

Freezer Storage Box 100 Place for Microcentrifuge tubes; Blue, 5 each Pk

Sign In for Pricing
View Details
Pnmt Mouse Pre-designed siRNA Set A
HY-RS20796 1 Set

Pnmt Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
EXOSC3 HDR Plasmid (h)
sc-403842-HDR 20 µg

EXOSC3 HDR Plasmid (h)

Sign In for Pricing
View Details
Anti-DDAH2 antibody
STJ70102 100 µg

Anti-DDAH2 antibody

Sign In for Pricing
View Details
Lemd2 ORF Vector (Rat) (pORF)
ORF069331 1.0 µg DNA

Lemd2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PTX3 siRNA (Mouse)
MBS8210416-01 15 nmol

PTX3 siRNA (Mouse)

Sign In for Pricing
View Details