Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP4 Peptide - N-terminal region

RASGRP4 Peptide - N-terminal region

Product Specifications

UniProt

C0LTP7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRP4 Rabbit Polyclonal Antibody (orb585229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139679

Preservative

Lyophilized powder

AA Sequence

FWATVAREGNSAQRRLGDSSDLLSPGGPGPPLPMSSPGLGKKRKVSLLFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteonectin (SPARC) Antibody
abx129998-01 100 µL

Osteonectin (SPARC) Antibody

Sign In for Pricing
View Details
Osteonectin (SPARC) Antibody
abx129998-02 200 µL

Osteonectin (SPARC) Antibody

Sign In for Pricing
View Details
Osteonectin (SPARC) Antibody
abx129998-03 1 mL

Osteonectin (SPARC) Antibody

Sign In for Pricing
View Details
SUMF1 Protein Vector (Human) (pPM-C-HA)
PV058475 500 ng

SUMF1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Lymphocyte Function Associated Antigen 1 Alpha (LFA1a)
MBS2093481-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Lymphocyte Function Associated Antigen 1 Alpha (LFA1a)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Lymphocyte Function Associated Antigen 1 Alpha (LFA1a)
MBS2093481-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Lymphocyte Function Associated Antigen 1 Alpha (LFA1a)

Sign In for Pricing
View Details