Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF6 Peptide - middle region

RASSF6 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686K23225

UniProt

Q6ZTQ3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF6 Rabbit Polyclonal Antibody (orb331063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958834

Preservative

Lyophilized powder

AA Sequence

VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOC3 Antibody
KC-1821-01 50 μL

APOC3 Antibody

Sign In for Pricing
View Details
APOC3 Antibody
KC-1821-02 100 µL

APOC3 Antibody

Sign In for Pricing
View Details
APOC3 Antibody
KC-1821-03 1 mL

APOC3 Antibody

Sign In for Pricing
View Details
CYB5R3 Rabbit Polyclonal Antibody
TA368144 100 µL

CYB5R3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXH1 (NM_003923) Human Over-expression Lysate
LC401291 20 µg

FOXH1 (NM_003923) Human Over-expression Lysate

Sign In for Pricing
View Details
BC-1382
TRC-B129353-10MG 10 mg

BC-1382

Sign In for Pricing
View Details