Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbbp5 Peptide - N-terminal region

Rbbp5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4933411J24Rik, C330016J05

UniProt

Q8BX09

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbbp5 Rabbit Polyclonal Antibody (orb576730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766105

Preservative

Lyophilized powder

AA Sequence

LLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ras Homolog Family Member D (RHOD) Antibody
abx004955-01 60 µL

Ras Homolog Family Member D (RHOD) Antibody

Sign In for Pricing
View Details
Ras Homolog Family Member D (RHOD) Antibody
abx004955-02 120 µL

Ras Homolog Family Member D (RHOD) Antibody

Sign In for Pricing
View Details
Ras Homolog Family Member D (RHOD) Antibody
abx004955-03 200 µL

Ras Homolog Family Member D (RHOD) Antibody

Sign In for Pricing
View Details
Sartorius Filter Paper G292 270mm Folded
SAR2037 100 / PCK

Sartorius Filter Paper G292 270mm Folded

Sign In for Pricing
View Details
Iqcf3-set siRNA/shRNA/RNAi Lentivector (Mouse)
25053094 4x 500 ng

Iqcf3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Adenosine Monophosphate Deaminase 2 (AMPD2)
MBS2166506-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Adenosine Monophosphate Deaminase 2 (AMPD2)

Sign In for Pricing
View Details