Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP8 Peptide - middle region

RBBP8 Peptide - middle region

Product Specifications

Product Name Alternative

CTIP, RIM, JWDS, SAE2, SCKL2

UniProt

A6NKN2

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBBP8 Rabbit Polyclonal Antibody (orb581253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976037

Preservative

Lyophilized powder

AA Sequence

CQQKKEKRNWLPAQDTDSATFHPTHQRIFGKLVFLPLRLVWKEVILRKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinquin Ethyl Ester
TRC-Z450000-5MG 5 mg

Zinquin Ethyl Ester

Sign In for Pricing
View Details
Tropomodulin 1 (TMOD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C2]
TA503170BM 100 µL

Tropomodulin 1 (TMOD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C2]

Sign In for Pricing
View Details
NF-kB p105/p50 Recombinant Rabbit Monoclonal Antibody [SZ20-01]
ET1603-18 100 µL

NF-kB p105/p50 Recombinant Rabbit Monoclonal Antibody [SZ20-01]

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF647 conjugate, 0.1mg/mL
BNC471557-500 1x 500 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hephaestin (HEPH) (NM_014799) Human Recombinant Protein
TP304175M 100 µg

Hephaestin (HEPH) (NM_014799) Human Recombinant Protein

Sign In for Pricing
View Details
Human HDAC8 activation kit by CRISPRa
GA111031 1 Kit

Human HDAC8 activation kit by CRISPRa

Sign In for Pricing
View Details