Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM18 Peptide - middle region

RBM18 Peptide - middle region

Product Specifications

Product Name Alternative

MGC2734

UniProt

Q96H35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM18 Rabbit Polyclonal Antibody (orb324930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149108

Preservative

Lyophilized powder

AA Sequence

VRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[[2-[2-[(6-Chlorohexyl)oxy]ethoxy]ethyl]amino]-4-oxo-butanoic Acid
TRC-C368543-50MG 50 mg

4-[[2-[2-[(6-Chlorohexyl)oxy]ethoxy]ethyl]amino]-4-oxo-butanoic Acid

Sign In for Pricing
View Details
MTHFR Mouse Monoclonal Antibody [Clone ID: 5D3]
AM06617SU-N 100 µL

MTHFR Mouse Monoclonal Antibody [Clone ID: 5D3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS705753 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1B3]
CF804233 100 µg

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1B3]

Sign In for Pricing
View Details
Human HSZFP36 (ZNF823) activation kit by CRISPRa
GA110785 1 Kit

Human HSZFP36 (ZNF823) activation kit by CRISPRa

Sign In for Pricing
View Details
Typhaneoside
TRC-T947750-25MG 25 mg

Typhaneoside

Sign In for Pricing
View Details