Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM18 Peptide - middle region

RBM18 Peptide - middle region

Product Specifications

Product Name Alternative

MGC2734

UniProt

Q96H35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM18 Rabbit Polyclonal Antibody (orb324930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149108

Preservative

Lyophilized powder

AA Sequence

VRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE 1 (TLE1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F9]
TA800303AM 100 µL

TLE 1 (TLE1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F9]

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
E-AB-90065-01 60 µL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
E-AB-90065-02 120 µL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB4 Polyclonal Antibody
E-AB-90065-03 200 µL

HLA-DRB4 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human DES protein (His tag)
PDEH100851-01 20 µg

Recombinant Human DES protein (His tag)

Sign In for Pricing
View Details
Recombinant Human DES protein (His tag)
PDEH100851-02 100 µg

Recombinant Human DES protein (His tag)

Sign In for Pricing
View Details