Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm3 Peptide - N-terminal region

Rbm3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2600016C11Rik, MGC118410

UniProt

Q8BG13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbm3 Rabbit Polyclonal Antibody (orb330111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058089

Preservative

Lyophilized powder

AA Sequence

LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (AP)
MBS6133073-01 0.1 mL

POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (AP)

Sign In for Pricing
View Details
POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (AP)
MBS6133073-02 5x 0.1 mL

POU6F1 (BRN5, MPOU, TCFB1, POU Domain, Class 6, Transcription Factor 1, Brain-specific Homeobox/POU Domain Protein 5, mPOU Homeobox Protein) (AP)

Sign In for Pricing
View Details
RFNG rabbit pAb
RA34433-01 50 µL

RFNG rabbit pAb

Sign In for Pricing
View Details
RFNG rabbit pAb
RA34433-02 100 µL

RFNG rabbit pAb

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase XII/CA12 Antibody (012) [DyLight 405]
NBP2-90352V 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase XII/CA12 Antibody (012) [DyLight 405]

Sign In for Pricing
View Details
P-MEK-3/6 (B-9) PE
sc-8407 PE 200 µg/mL

P-MEK-3/6 (B-9) PE

Sign In for Pricing
View Details