Rbm3 Peptide - N-terminal region
Rbm3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2600016C11Rik, MGC118410
UniProt
Q8BG13
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rbm3 Rabbit Polyclonal Antibody (orb330111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_058089
Preservative
Lyophilized powder
AA Sequence
LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
D1065-50C 100 Tests
DARC (Duffy Antigen, Fy Glycoprotein, GpFy, Cell Adhesion Molecule 3, CADM3) (PE)
Sign In for Pricing
View Details R0444-67F-APC 200 µL
Rad9, phosphorylated (Ser341) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (APC) discontinued
Sign In for Pricing
View Details 
GTR10418564 96 Well
Bovine 5-aminolevulinate synthase, erythroid-specific, mitochondrial
Sign In for Pricing
View Details