Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM42 Peptide - middle region

RBM42 Peptide - middle region

Product Specifications

Product Name Alternative

MGC10433

UniProt

Q9BTD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM42 Rabbit Polyclonal Antibody (orb577863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077297

Preservative

Lyophilized powder

AA Sequence

RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK17 Antibody
8C17780-AAT 50 µg

KCNK17 Antibody

Sign In for Pricing
View Details
TentaGel® MB FMP
MB160160.1G 1 g

TentaGel® MB FMP

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL
BNC403124-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H3.3B (H3F3B) (NM_005324) Human Over-expression Lysate
LY401642 100 µg

H3.3B (H3F3B) (NM_005324) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCDC124 activation kit by CRISPRa
GA114507 1 Kit

Human CCDC124 activation kit by CRISPRa

Sign In for Pricing
View Details
IRE1 (ERN1) (NM_001433) Human Over-expression Lysate
LY419940 100 µg

IRE1 (ERN1) (NM_001433) Human Over-expression Lysate

Sign In for Pricing
View Details