Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM42 Peptide - middle region

RBM42 Peptide - middle region

Product Specifications

Product Name Alternative

MGC10433

UniProt

Q9BTD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM42 Rabbit Polyclonal Antibody (orb577863) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077297

Preservative

Lyophilized powder

AA Sequence

RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Superoxide Dismutase 1 (SOD1) Rabbit Monoclonal Antibody [Clone ID: R07-1G6]
TA385301 100 µL

Superoxide Dismutase 1 (SOD1) Rabbit Monoclonal Antibody [Clone ID: R07-1G6]

Sign In for Pricing
View Details
Bulk Anti-Human CD56 (ERIC-1) Antibody
ICH1015-25mg 25 mg

Bulk Anti-Human CD56 (ERIC-1) Antibody

Sign In for Pricing
View Details
Cyclin B2 (X29.2), CF594 conjugate, 0.1mg/mL
BNC943059-100 1x 100 µL

Cyclin B2 (X29.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RH 9886
TRC-R315770-5MG 5 mg

RH 9886

Sign In for Pricing
View Details
Acetylpyruvic Acid
TRC-A163940-1G 1 g

Acetylpyruvic Acid

Sign In for Pricing
View Details
ZNF140 antibody
FNab09657 100 µg

ZNF140 antibody

Sign In for Pricing
View Details