Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMX Peptide - C-terminal region

RBMX Peptide - C-terminal region

Product Specifications

Product Name Alternative

HNRPG, RBMXP1, RBMXRT, RNMX, hnRNP-G

UniProt

P38159

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBMX Rabbit Polyclonal Antibody (orb331148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002130

Preservative

Lyophilized powder

AA Sequence

SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fhl2 shRNA (UAS) - Lentiviral mouse Fhl2 shRNA (UAS) plasmid
GTR15236947 1 Vial

Lentiviral mouse Fhl2 shRNA (UAS) - Lentiviral mouse Fhl2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Nelfe shRNA (UAS) - Lentiviral mouse Nelfe shRNA (UAS, iRFP) plasmid
GTR15146488 1 Vial

Lentiviral mouse Nelfe shRNA (UAS) - Lentiviral mouse Nelfe shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CD46 Recombinant Antibody, Cy3 Conjugated
bsm-54335R-Cy3 100 µL

CD46 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human Agrin (AGRN) ELISA Kit
orb2984439 96 Tests

Human Agrin (AGRN) ELISA Kit

Sign In for Pricing
View Details
ATP9B HDR Plasmid (h)
sc-410442-HDR 20 µg

ATP9B HDR Plasmid (h)

Sign In for Pricing
View Details
Aflatoxin B1, B2 (PE) discontinued
A0925-04-PE 100 µL

Aflatoxin B1, B2 (PE) discontinued

Sign In for Pricing
View Details