Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCVRN Peptide - C-terminal region

RCVRN Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCV1

UniProt

P35243

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCVRN Rabbit Polyclonal Antibody (orb574963) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002894

Preservative

Lyophilized powder

AA Sequence

DVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS1 Antibody
orb685236 100 µL

RGS1 Antibody

Sign In for Pricing
View Details
SBNO1 Polyclonal Antibody, Cy3 Conjugated
bs-17251R-Cy3 100 µL

SBNO1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Human AFG3 like protein 1 (AFG3L1) ELISA kit
GTR10452593 96 Well

Human AFG3 like protein 1 (AFG3L1) ELISA kit

Sign In for Pricing
View Details
DNAJC15 Human Pre-designed siRNA Set A
HY-RS03878 1 Set

DNAJC15 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
TAK-733 2mg
A11040-2 2 mg

TAK-733 2mg

Sign In for Pricing
View Details
IL-23 Peptide
3795P 0.05 mg

IL-23 Peptide

Sign In for Pricing
View Details