Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCVRN Peptide - C-terminal region

RCVRN Peptide - C-terminal region

Product Specifications

Product Name Alternative

RCV1

UniProt

P35243

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCVRN Rabbit Polyclonal Antibody (orb574963) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002894

Preservative

Lyophilized powder

AA Sequence

DVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIH/3T3-EML4-ALK-C1156Y-G1296A Overexpressing Cell Line
RG-1460 5x 10^6

NIH/3T3-EML4-ALK-C1156Y-G1296A Overexpressing Cell Line

Sign In for Pricing
View Details
Human ASB10 (NM_001142460) AAV Particle
RC227841A1V 250 µL

Human ASB10 (NM_001142460) AAV Particle

Sign In for Pricing
View Details
CLPS Polyclonal Antibody
A73090-100 100 µL

CLPS Polyclonal Antibody

Sign In for Pricing
View Details
Olfr172 Protein Lysate (Mouse) with C-HA Tag
32955034 100 µg

Olfr172 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SIRPB1 antibody
70R-20278 50 ul

SIRPB1 antibody

Sign In for Pricing
View Details
(2-Cyclopropyl-3-methyloxolan-3-yl) methanamine hydrochloride
DXC58384-01 50 mg

(2-Cyclopropyl-3-methyloxolan-3-yl) methanamine hydrochloride

Sign In for Pricing
View Details