Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rdh10 Peptide - C-terminal region

Rdh10 Peptide - C-terminal region

Product Specifications

UniProt

Q80ZF7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rdh10 Rabbit Polyclonal Antibody (orb581996) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852143

Preservative

Lyophilized powder

AA Sequence

CPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit free thyroxine, FT4 ELISA KIT
EA0033Rb-01 96 Well

Rabbit free thyroxine, FT4 ELISA KIT

Sign In for Pricing
View Details
Rabbit free thyroxine, FT4 ELISA KIT
EA0033Rb-02 5x 96 Tests

Rabbit free thyroxine, FT4 ELISA KIT

Sign In for Pricing
View Details
Rabbit free thyroxine, FT4 ELISA KIT
EA0033Rb-03 10x 96 Tests

Rabbit free thyroxine, FT4 ELISA KIT

Sign In for Pricing
View Details
ZNF486 Peptide
MBS3235333-01 0.1 mg

ZNF486 Peptide

Sign In for Pricing
View Details
ZNF486 Peptide
MBS3235333-02 5x 0.1 mg

ZNF486 Peptide

Sign In for Pricing
View Details
Chicken Vitamin D Receptor (VDR) ELISA Kit
MBS263121-01 48 Well

Chicken Vitamin D Receptor (VDR) ELISA Kit

Sign In for Pricing
View Details