Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH13 Peptide - C-terminal region

RDH13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp313H0740, FLJ39479, SDR7C3

UniProt

Q8NBN7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RDH13 Rabbit Polyclonal Antibody (orb585327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139443

Preservative

Lyophilized powder

AA Sequence

PSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ovcar5 Cells
T1039 1x106 cells / 1.0 mL

Ovcar5 Cells

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Large-conductance mechanosensitive channel (mscL)
MBS7021284-01 0.02 mg

Recombinant Synechococcus elongatus Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Large-conductance mechanosensitive channel (mscL)
MBS7021284-02 0.1 mg

Recombinant Synechococcus elongatus Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Synechococcus elongatus Large-conductance mechanosensitive channel (mscL)
MBS7021284-03 5x 0.1 mg

Recombinant Synechococcus elongatus Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Hsa-miR-4498 miRNA Antagomir
orb1914987-01 10 nmol

Hsa-miR-4498 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4498 miRNA Antagomir
orb1914987-02 20 nmol

Hsa-miR-4498 miRNA Antagomir

Sign In for Pricing
View Details