Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH13 Peptide - C-terminal region

RDH13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp313H0740, FLJ39479, SDR7C3

UniProt

Q8NBN7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RDH13 Rabbit Polyclonal Antibody (orb585327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139443

Preservative

Lyophilized powder

AA Sequence

PSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5C2 Rabbit Polyclonal Antibody (BF555)
orb2558607 100 µL

NT5C2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Putative lipase ATG15 (ATG15), partial
MBS1441067 Inquire

Recombinant Ashbya gossypii Putative lipase ATG15 (ATG15), partial

Sign In for Pricing
View Details
SPINT2 (NM_001166103) Human Tagged Lenti ORF Clone
RC228127L4 10 µg

SPINT2 (NM_001166103) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Zebrafish dusp4 Rabbit Polyclonal Antibody (FITC)
orb2571509 200 µL

Zebrafish dusp4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anti-Hsc70 antibody
MBS176287-01 0.01 mg

Anti-Hsc70 antibody

Sign In for Pricing
View Details
Anti-Hsc70 antibody
MBS176287-02 0.1 mg (Carrier Free)

Anti-Hsc70 antibody

Sign In for Pricing
View Details