Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH16 Peptide - middle region

RDH16 Peptide - middle region

Product Specifications

Product Name Alternative

RODH-4, SDR9C8

UniProt

O75452

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RDH16 Rabbit Polyclonal Antibody (orb578353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003699

Preservative

Lyophilized powder

AA Sequence

SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Capsid Protein VP1. Recombinant, Porcine parvovirus, aa1-207, His-Tag
583897-01 20 µg

Capsid Protein VP1. Recombinant, Porcine parvovirus, aa1-207, His-Tag

Sign In for Pricing
View Details
Capsid Protein VP1. Recombinant, Porcine parvovirus, aa1-207, His-Tag
583897-02 100 µg

Capsid Protein VP1. Recombinant, Porcine parvovirus, aa1-207, His-Tag

Sign In for Pricing
View Details
Mae1 Antibody
orb854509 2 mg

Mae1 Antibody

Sign In for Pricing
View Details
Anti-HMGCR Antibody Picoband
MBS1754776-01 0.01 mg

Anti-HMGCR Antibody Picoband

Sign In for Pricing
View Details
Anti-HMGCR Antibody Picoband
MBS1754776-02 0.1 mg (Carrier Free)

Anti-HMGCR Antibody Picoband

Sign In for Pricing
View Details
Anti-HMGCR Antibody Picoband
MBS1754776-03 0.1 mg

Anti-HMGCR Antibody Picoband

Sign In for Pricing
View Details