Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH16 Peptide - middle region

RDH16 Peptide - middle region

Product Specifications

Product Name Alternative

RODH-4, SDR9C8

UniProt

O75452

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RDH16 Rabbit Polyclonal Antibody (orb578353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003699

Preservative

Lyophilized powder

AA Sequence

SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Prostaglandin D2 ELISA Kit
MBS744853-01 48 Well

Rabbit Prostaglandin D2 ELISA Kit

Sign In for Pricing
View Details
Rabbit Prostaglandin D2 ELISA Kit
MBS744853-02 96 Well

Rabbit Prostaglandin D2 ELISA Kit

Sign In for Pricing
View Details
Rabbit Prostaglandin D2 ELISA Kit
MBS744853-03 5x 96 Well

Rabbit Prostaglandin D2 ELISA Kit

Sign In for Pricing
View Details
Rabbit Prostaglandin D2 ELISA Kit
MBS744853-04 10x 96 Well

Rabbit Prostaglandin D2 ELISA Kit

Sign In for Pricing
View Details
Human CHAT Pre-designed siRNA Set B
SI002966B 1 Each

Human CHAT Pre-designed siRNA Set B

Sign In for Pricing
View Details
HSP90 (human), (native)
ADI-SPP-770-D 50 µg

HSP90 (human), (native)

Sign In for Pricing
View Details