Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RERG Peptide - C-terminal region

RERG Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC15754

UniProt

Q96A58

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RERG Rabbit Polyclonal Antibody (orb584414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116307

Preservative

Lyophilized powder

AA Sequence

PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crygs Antibody - C-terminal region : FITC (ARP52379_P050-FITC)
ARP52379_P050-FITC 100 µL

Crygs Antibody - C-terminal region : FITC (ARP52379_P050-FITC)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)
MBS1126018-01 0.02 mg (E-Coli)

Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)
MBS1126018-02 0.1 mg (E-Coli)

Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)
MBS1126018-03 0.02 mg (Yeast)

Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)
MBS1126018-04 0.1 mg (Yeast)

Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)
MBS1126018-05 0.02 mg (Baculovirus)

Recombinant Borrelia burgdorferi V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details