Rerg Peptide - middle region
Rerg Peptide - middle region
Product Specifications
Product Name Alternative
RGD1562829
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rerg Rabbit Polyclonal Antibody (orb584415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_001072746
Preservative
Lyophilized powder
AA Sequence
NILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLASELACAFYECSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC226118L4 10 µg
Gelsolin (GSN) (NM_001127663) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
orb2912793-01 20 µg
Recombinant Actinobacillus pleuropneumoniae serotype 5b Glycerol-3-phosphate acyltransferase (plsY)
Sign In for Pricing
View Details