Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rerg Peptide - middle region

Rerg Peptide - middle region

Product Specifications

Product Name Alternative

RGD1562829

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rerg Rabbit Polyclonal Antibody (orb584415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001072746

Preservative

Lyophilized powder

AA Sequence

NILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLASELACAFYECSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclo (Tyr-Leu) 100mg
A23538-100 100 mg

Cyclo (Tyr-Leu) 100mg

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS640797 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
TFRC Monoclonal Antibody, PE Conjugated
bsm-43165M-PE 100 µL

TFRC Monoclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
DAPP1 (NM_014395) Human Tagged ORF Clone Lentiviral Particle
RC215474L2V 200 µL

DAPP1 (NM_014395) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TSC22D1 Antibody
MBS8514034-01 0.1 mg

TSC22D1 Antibody

Sign In for Pricing
View Details
TSC22D1 Antibody
MBS8514034-02 0.1 mL (AF635)

TSC22D1 Antibody

Sign In for Pricing
View Details