Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rest Peptide - middle region

Rest Peptide - middle region

Product Specifications

Product Name Alternative

2610008J04Rik, AA407358, MGC150099, NRSF

UniProt

Q8VIG1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rest Rabbit Polyclonal Antibody (orb576774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035393

Preservative

Lyophilized powder

AA Sequence

ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15orf15 (RSL24D1) (NM_016304) Human Tagged Lenti ORF Clone
RC203261L3 10 µg

C15orf15 (RSL24D1) (NM_016304) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-Human TARDBP pAb
PA4429-01 50 μL

Rabbit Anti-Human TARDBP pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TARDBP pAb
PA4429-02 100 μL

Rabbit Anti-Human TARDBP pAb

Sign In for Pricing
View Details
MTERF1 Polyclonal Antibody, Biotin Conjugated
bs-13340R-Biotin 100 µL

MTERF1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Sulphadimethoxine
S1962-50mg 50 mg

Sulphadimethoxine

Sign In for Pricing
View Details
Rabbit anti-human nucleophosmin/nucleoplasmin, 3 polyclonal Antibody
MBS710936-01 0.1 mL

Rabbit anti-human nucleophosmin/nucleoplasmin, 3 polyclonal Antibody

Sign In for Pricing
View Details