Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC2 Peptide - middle region

RFC2 Peptide - middle region

Product Specifications

Product Name Alternative

A1, MGC3665, RFC40

UniProt

Q75MT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RFC2 Rabbit Polyclonal Antibody (orb585060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002905

Preservative

Lyophilized powder

AA Sequence

IQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROX2 (NM_001080408) Human Over-expression Lysate
LS283571-100ug 100 µg

PROX2 (NM_001080408) Human Over-expression Lysate

Sign In for Pricing
View Details
NDUFB3 Conjugated Antibody
MBS9451222-01 0.1 mL (Biotin)

NDUFB3 Conjugated Antibody

Sign In for Pricing
View Details
NDUFB3 Conjugated Antibody
MBS9451222-02 0.1 mL (AF350)

NDUFB3 Conjugated Antibody

Sign In for Pricing
View Details
NDUFB3 Conjugated Antibody
MBS9451222-03 0.1 mL (AF405)

NDUFB3 Conjugated Antibody

Sign In for Pricing
View Details
NDUFB3 Conjugated Antibody
MBS9451222-04 0.1 mL (AF488)

NDUFB3 Conjugated Antibody

Sign In for Pricing
View Details
NDUFB3 Conjugated Antibody
MBS9451222-05 0.1 mL (AF555)

NDUFB3 Conjugated Antibody

Sign In for Pricing
View Details