Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC2 Peptide - middle region

RFC2 Peptide - middle region

Product Specifications

Product Name Alternative

A1, MGC3665, RFC40

UniProt

Q75MT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RFC2 Rabbit Polyclonal Antibody (orb585060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002905

Preservative

Lyophilized powder

AA Sequence

IQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Tyr(PO3H2)-OH
F-4180.0005 5.0g

H-Tyr(PO3H2)-OH

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)
MBS1021263-01 0.02 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)
MBS1021263-02 0.1 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)
MBS1021263-03 0.02 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)
MBS1021263-04 0.1 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)
MBS1021263-05 0.02 mg (Baculovirus)

Recombinant Campylobacter fetus subsp. fetus 10 kDa chaperonin (groS)

Sign In for Pricing
View Details