Rfxap Peptide - middle region
Rfxap Peptide - middle region
Product Specifications
Product Name Alternative
5730495K23Rik
UniProt
Q8VCG9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rfxap Rabbit Polyclonal Antibody (orb576311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_573494
Preservative
Lyophilized powder
AA Sequence
CTYEGCRETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALGSGGPSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
QP8805-ec-10ug 10ug
Recombinant S. cerevisiae Adenosylhomocysteinase Protein, His, E.coli-10ug
Sign In for Pricing
View Details 
MBS2098965-01 5x 96 Tests
General Cortisol (Cor) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2098965-02 5x 96 Tests + MBS2090686 (Ab Pairs Support Pack 2,5x 96 Tests)
General Cortisol (Cor) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2098965-03 10x 96 Tests
General Cortisol (Cor) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2098965-04 10x 96 Tests + MBS2090686 (Ab Pairs Support Pack 2, 10x 96 Tests)
General Cortisol (Cor) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details