Rfxap Peptide - middle region
Rfxap Peptide - middle region
Product Specifications
Product Name Alternative
5730495K23Rik
UniProt
Q8VCG9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rfxap Rabbit Polyclonal Antibody (orb576311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_573494
Preservative
Lyophilized powder
AA Sequence
CTYEGCRETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALGSGGPSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP72179-01 20 µg
Recombinant Human Tumor necrosis factor alpha-induced protein 8(TNFAIP8)
Sign In for Pricing
View Details AP72179-02 100 µg
Recombinant Human Tumor necrosis factor alpha-induced protein 8(TNFAIP8)
Sign In for Pricing
View Details AP72179-03 1 mg
Recombinant Human Tumor necrosis factor alpha-induced protein 8(TNFAIP8)
Sign In for Pricing
View Details 
31624141 1x 10^6 Cells / 1.0 mL
NDUFA5 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details