Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RG9MTD1 Peptide - middle region

RG9MTD1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20432, MRPP1, RG9MTD1

UniProt

Q7L0Y3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RG9MTD1 Rabbit Polyclonal Antibody (orb577815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060289

Preservative

Lyophilized powder

AA Sequence

MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DC-SIGN Antibody (PE), Mouse Monoclonal
MBS8101656-01 25 Tests

Anti-DC-SIGN Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-DC-SIGN Antibody (PE), Mouse Monoclonal
MBS8101656-02 100 Tests

Anti-DC-SIGN Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-DC-SIGN Antibody (PE), Mouse Monoclonal
MBS8101656-03 5x 100 Tests

Anti-DC-SIGN Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
RPL23AP14 AAV siRNA Pooled Vector
41136161 1.0 µg

RPL23AP14 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CCDC91 Human Gene Knockout Kit (CRISPR)
KN415991 1 Kit

CCDC91 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GNAQ, NT (GNAQ, GAQ, Guanine nucleotide-binding protein G(q) subunit alpha, Guanine nucleotide-binding protein alpha-q) (Azide free) (HRP)
MBS6302923-01 0.2 mL

GNAQ, NT (GNAQ, GAQ, Guanine nucleotide-binding protein G(q) subunit alpha, Guanine nucleotide-binding protein alpha-q) (Azide free) (HRP)

Sign In for Pricing
View Details