Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RG9MTD1 Peptide - middle region

RG9MTD1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20432, MRPP1, RG9MTD1

UniProt

Q7L0Y3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RG9MTD1 Rabbit Polyclonal Antibody (orb577815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060289

Preservative

Lyophilized powder

AA Sequence

MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2K7 Antibody, HRP conjugated
CSB-PA013416LB01HU-01 50 µg

MAP2K7 Antibody, HRP conjugated

Sign In for Pricing
View Details
MAP2K7 Antibody, HRP conjugated
CSB-PA013416LB01HU-02 100 µg

MAP2K7 Antibody, HRP conjugated

Sign In for Pricing
View Details
CRBN ligand-361
HY-W953311 1 Each

CRBN ligand-361

Sign In for Pricing
View Details
Recombinant Rat LTB4R2 Protein, His (Fc)-Avi-tagged
LTB4R2-3155R 50 µg

Recombinant Rat LTB4R2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
C9orf50 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-15331R-BF555 100 µL

C9orf50 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PXMP2 Antibody : FITC (OAAF03990-FITC)
OAAF03990-100UG-FITC 100 µg

PXMP2 Antibody : FITC (OAAF03990-FITC)

Sign In for Pricing
View Details