Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODR4 Peptide - C-terminal region

ODR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1307830

UniProt

D3ZV63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ODR4 Rabbit Polyclonal Antibody (orb325337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_222746

Preservative

Lyophilized powder

AA Sequence

SGSVNLRGNVRCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Semaphorin 5A/SEMA5A Protein (aa 23-765, His Tag)
PKSH033024-01 10 µg

Recombinant Human Semaphorin 5A/SEMA5A Protein (aa 23-765, His Tag)

Sign In for Pricing
View Details
Recombinant Human Semaphorin 5A/SEMA5A Protein (aa 23-765, His Tag)
PKSH033024-02 50 µg

Recombinant Human Semaphorin 5A/SEMA5A Protein (aa 23-765, His Tag)

Sign In for Pricing
View Details
5HT3A receptor (HTR3A) Rabbit Polyclonal Antibody
AP20471PU-N 100 µg

5HT3A receptor (HTR3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fosmidomycin Sodium Salt
TRC-F728500-10MG 10 mg

Fosmidomycin Sodium Salt

Sign In for Pricing
View Details
PSMA (FOLH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B10]
TA814043AM 100 µL

PSMA (FOLH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B10]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS706570 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details