Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGL3 Peptide - middle region

RGL3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ00153, FLJ32585, FLJ44275, MGC126805, MGC138163

UniProt

Q3MIN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGL3 Rabbit Polyclonal Antibody (orb326084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030300

Preservative

Lyophilized powder

AA Sequence

LDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rho A Antibody [G4B13]
C15172-100uL 100 µL

Rho A Antibody [G4B13]

Sign In for Pricing
View Details
KHDRBS3 Protein Vector (Mouse) (pPM-C-HA)
25507024 500 ng

KHDRBS3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
7-Ethylquinoline-2,3-dicarboxylic acid diethyl ester
sc-291584 250 mg

7-Ethylquinoline-2,3-dicarboxylic acid diethyl ester

Sign In for Pricing
View Details
Anti-F13A1 Antibody (Biotin)
STJ501105 100 µg

Anti-F13A1 Antibody (Biotin)

Sign In for Pricing
View Details
PCMV-Fxr1-3xHA-Neo Plasmid
PVT70573 2 µg

PCMV-Fxr1-3xHA-Neo Plasmid

Sign In for Pricing
View Details
Homoferreirin
MBS5790294 Inquire

Homoferreirin

Sign In for Pricing
View Details