Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGL3 Peptide - middle region

RGL3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ00153, FLJ32585, FLJ44275, MGC126805, MGC138163

UniProt

Q3MIN7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGL3 Rabbit Polyclonal Antibody (orb326084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030300

Preservative

Lyophilized powder

AA Sequence

LDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)
abx344038-01 20 µg

Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)

Sign In for Pricing
View Details
Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)
abx344038-02 50 µg

Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)

Sign In for Pricing
View Details
Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)
abx344038-03 100 µg

Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)

Sign In for Pricing
View Details
Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)
abx344038-04 200 µg

Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)

Sign In for Pricing
View Details
Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)
abx344038-05 1 mg

Phosphofurin acidic cluster sorting protein 1 (PACS1) Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral human FZD6 shRNA (UAS) - Lentiviral human FZD6 shRNA (UAS, GFP) (100)
GTR15347100 1 Vial

Lentiviral human FZD6 shRNA (UAS) - Lentiviral human FZD6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details