RGMB Peptide - C-terminal region
RGMB Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp434P228, DRAGON, FLJ90406, MGC86970
UniProt
Q6NW40
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RGMB Rabbit Polyclonal Antibody (orb585256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012779
Preservative
Lyophilized powder
AA Sequence
LTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6354501-01 0.2 mL
TCF3, CT (TCF3, BHLHB21, E2A, ITF1, Transcription factor E2-alpha, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, Transcription factor 3, Transcrip
Sign In for Pricing
View Details MBS6354501-02 5x 0.2 mL
TCF3, CT (TCF3, BHLHB21, E2A, ITF1, Transcription factor E2-alpha, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, Transcription factor 3, Transcrip
Sign In for Pricing
View Details 242488-01 5 mL
Trimethoxy[2- (7-oxabicyclo[4.1.0]hept-3-yl) ethyl]silane ≥97% (GC)
Sign In for Pricing
View Details 242488-02 25 mL
Trimethoxy[2- (7-oxabicyclo[4.1.0]hept-3-yl) ethyl]silane ≥97% (GC)
Sign In for Pricing
View Details 242488-03 100 mL
Trimethoxy[2- (7-oxabicyclo[4.1.0]hept-3-yl) ethyl]silane ≥97% (GC)
Sign In for Pricing
View Details 242488-04 250 mL
Trimethoxy[2- (7-oxabicyclo[4.1.0]hept-3-yl) ethyl]silane ≥97% (GC)
Sign In for Pricing
View Details