Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGMB Peptide - C-terminal region

RGMB Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434P228, DRAGON, FLJ90406, MGC86970

UniProt

Q6NW40

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGMB Rabbit Polyclonal Antibody (orb585256) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012779

Preservative

Lyophilized powder

AA Sequence

LTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS5 Antibody
CSB-PA02735A0Rb-01 50 µg

NDUFS5 Antibody

Sign In for Pricing
View Details
NDUFS5 Antibody
CSB-PA02735A0Rb-02 100 µg

NDUFS5 Antibody

Sign In for Pricing
View Details
GLT1D1 Antibody, Biotin conjugated
A63790-100UG 100 µg

GLT1D1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Ethyl 2-bromo-5-fluorobenzoate
PC53349-01 5 g

Ethyl 2-bromo-5-fluorobenzoate

Sign In for Pricing
View Details
Ethyl 2-bromo-5-fluorobenzoate
PC53349-02 25 g

Ethyl 2-bromo-5-fluorobenzoate

Sign In for Pricing
View Details
Ethyl 2-bromo-5-fluorobenzoate
PC53349-03 100 g

Ethyl 2-bromo-5-fluorobenzoate

Sign In for Pricing
View Details