Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rgs1 Peptide - N-terminal region

Rgs1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BL34

UniProt

Q9JL25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rgs1 Rabbit Polyclonal Antibody (orb578621) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056626

Preservative

Lyophilized powder

AA Sequence

MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSPE-PEG1000-VIP
HY-172680 1 Each

DSPE-PEG1000-VIP

Sign In for Pricing
View Details
Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit
MBS7207389-01 48 Well

Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit

Sign In for Pricing
View Details
Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit
MBS7207389-02 96 Well

Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit

Sign In for Pricing
View Details
Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit
MBS7207389-03 5x 96 Well

Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit

Sign In for Pricing
View Details
Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit
MBS7207389-04 10x 96 Well

Human Charged multivesicular body protein 5 (CHMP5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IL3RA protein, Fc-His-tagged, R-PE labeled
IL3RA-3248HP 20 µg

Recombinant Human IL3RA protein, Fc-His-tagged, R-PE labeled

Sign In for Pricing
View Details