Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS18 Peptide - middle region

RGS18 Peptide - middle region

Product Specifications

Product Name Alternative

RGS13

UniProt

Q9NS28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGS18 Rabbit Polyclonal Antibody (orb330259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570138

Preservative

Lyophilized powder

AA Sequence

EDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XAB2 Rabbit Polyclonal Antibody
TA365163 100 µL

XAB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199E-01 50 Tests

APC Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199E-02 100 Tests

APC Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
APC Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199E-03 2x 100 Tests

APC Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
PCBP3 (NM_020528) Human Over-expression Lysate
LC432200 20 µg

PCBP3 (NM_020528) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Phenylpropylamine
TRC-P336055-1G 1 g

3-Phenylpropylamine

Sign In for Pricing
View Details